Cox6b1 (NM_025628) Mouse Tagged ORF Clone

CAT#: MR200188

Reviews ()
Write a review
  • TrueORF®

Cox6b1 (Myc-DDK-tagged) - Mouse cytochrome c oxidase, subunit VIb polypeptide 1 (Cox6b1), nuclear gene encoding mitochondrial protein



  "NM_025628" in other vectors (4)

Interest in protein/lysate? Submit request here!

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Cox6b1 (NM_025628) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Cox6b1
Synonyms 2010000G05Rik; Cox6b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR200188 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGACATCAAGACTAAAATCAAGAACTACAAAACTGCCCCCTTTGACAGCCGCTTCCCCAACC
AGAACCAGACTAAGAACTGTTGGCAGAACTACCTGGACTTCCACCGCTGTGAGAAGGCAATGACGGCCAA
GGGGGGTGATGTCTCCGTGTGTGAGTGGTACCGGCGTGTGTACAAGTCCCTCTGTCCCGTGTCATGGGTC
TCAGCCTGGGATGACCGCATAGCTGAAGGCACATTTCCTGGGAAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200188 protein sequence
Red=Cloning site Green=Tags(s)

MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWV
SAWDDRIAEGTFPGKI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025628
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025628.3
RefSeq Size 505 bp
RefSeq ORF 261 bp
Locus ID 110323
UniProt ID P56391
Cytogenetics 7 18.84 cM
MW 10.1 kDa
Gene Summary Connects the two COX monomers into the physiological dimeric form.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Cox6b1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
Molbio tools