Galectin 7 (LGALS7) Rabbit Polyclonal Antibody

SKU TA358636

LGALS7 Antibody

Product Data

• Application: IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
• Specificity: Expected reactivity: Cow, Dog, Human, Mouse, Pig, Rat; Homology: Cow: 93%; Dog: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Stability: Shelf life: one year from despatch.
• Shipping: Blue Ice
• Predicted Protein Size: 15 kDa
• Gene Name: galectin 7
• Database Link:
  NP_002298
  P47929
• Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.
• Synonyms: Gal-7; GAL7; galectin-7; HKL-14; LGALS7A; PI7; PIG1; TP53I1

Reference Data

• Protein Families: Secreted Protein