Galectin 7 (LGALS7) Rabbit Polyclonal Antibody
Product Data | |
Application | IHC |
---|---|
Reactivity | Human |
Antibody Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP |
Specificity | Expected reactivity: Cow, Dog, Human, Mouse, Pig, Rat Homology: Cow: 93%; Dog: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86% |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Stability | Shelf life: one year from despatch. |
Shipping | Blue Ice |
Predicted Protein Size | 15 kDa |
Gene Name | galectin 7 |
Database Link | |
Background | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. |
Synonyms | Gal-7; GAL7; galectin-7; HKL-14; LGALS7A; PI7; PIG1; TP53I1 |
Reference Data | |
Protein Families | Secreted Protein |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.