GnRH (GNRH1) Rabbit Polyclonal Antibody

SKU
TA358540
GNRH1 Antibody
$575.00
5 Days*
Specifications
Product Data
Application IHC
Reactivity Human
Antibody Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS
Specificity Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Homology: Cow: 93%; Dog: 92%; Guinea Pig: 77%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 93%; Rat: 92%; Sheep: 86%
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Stability Shelf life: one year from despatch.
Shipping Blue Ice
Predicted Protein Size 10 kDa
Gene Name gonadotropin releasing hormone 1
Database Link
Background The protein encoded by this gene is secreted and then cleaved to form the 10 aa luteinizing hormone-releasing hormone (LHRH, also known as gonadoliberin-1), and prolactin release-inhibiting factor (also known as GnRH-associated peptide 1). LHRH stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutation in this gene are associated with hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been described for this gene.
Synonyms GNRH; GRH; LHRH; LNRH
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway
Write Your Own Review
You're reviewing:GnRH (GNRH1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.