RICTOR Rabbit Polyclonal Antibody
Product Data | |
Application | IHC |
---|---|
Reactivity | Human |
Antibody Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG |
Specificity | Expected reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat Homology: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 100% |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Stability | Shelf life: one year from despatch. |
Shipping | Blue Ice |
Predicted Protein Size | 192 kDa |
Gene Name | RPTOR independent companion of MTOR complex 2 |
Database Link | |
Background | RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).[supplied by OMIM, Mar 2008] |
Synonyms | AVO3; DKFZp686B11164; KIAA1999; mAVO3; MGC39830; PIA; pianissimo |
Reference Data | |
Protein Pathways | mTOR signaling pathway |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.