B3GNT4 Rabbit Polyclonal Antibody

SKU TA346843

Rabbit Polyclonal Anti-B3GNT4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
• Database Link:
  NP_110392
  Q9C0J1
• Background: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq, Jul 2008]
• Synonyms: B3GN-T4; beta3Gn-T4
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Pig: 92%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Pathways: Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways