NUDT18 Rabbit Polyclonal Antibody

SKU TA346833

Rabbit Polyclonal Anti-NUDT18 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the C terminal of human NUDT18. Synthetic peptide located within the following region: KGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKVM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: nudix hydrolase 18
• Database Link:
  NP_079091
  Q6ZVK8
• Background: The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012]
• Synonyms: MTH3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Horse: 92%; Dog: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data