NARG1L (NAA16) Rabbit Polyclonal Antibody

SKU TA346824

Rabbit Polyclonal Anti-NARG1L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NARG1L antibody: synthetic peptide directed towards the middle region of human NARG1L. Synthetic peptide located within the following region: RKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 101 kDa
• Gene Name: N(alpha)-acetyltransferase 16, NatA auxiliary subunit
• Database Link:
  NP_078837
  Q6N069
• Background: Auxillary subunit of the N-terminal acetyltransferase A (NatA) complex which displays alpha (N-terminal) acetyltransferase activity.
• Synonyms: NARG1L
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors