CHST6 Rabbit Polyclonal Antibody

SKU TA346812

Rabbit Polyclonal Anti-CHST6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHST6 antibody: synthetic peptide directed towards the middle region of human CHST6. Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: carbohydrate sulfotransferase 6
• Database Link:
  NP_067628
  Q9GZX3
• Background: The protein encoded by this gene is an enzyme that catalyzes the transfer of a sulfate group to the GlcNAc residues of keratan. Keratan sulfate helps maintain corneal transparency. Defects in this gene are a cause of macular corneal dystrophy (MCD). [provided by RefSeq, Jan 2010]
• Synonyms: MCDC1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Dog: 83%; Pig: 82%; Guinea pig: 82%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Pathways: Keratan sulfate biosynthesis, Metabolic pathways