Pomgnt1 Rabbit Polyclonal Antibody

SKU TA346788

Rabbit Polyclonal Anti-Pomgnt1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pomgnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 75 kDa
• Gene Name: protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase
• Database Link:
  NP_080927
  Q91X88
• Background: Participates in O-mannosyl glycosylation. May be responsible for the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins. Is specific for alpha linked terminal mannose.
• Synonyms: DKFZp761B182; FLJ20277; GNTI.2; MEB; MGAT1.2
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data