Naa60 Rabbit Polyclonal Antibody

SKU
TA346699
Rabbit Polyclonal Anti-Naa60 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Naa60 antibody is: synthetic peptide directed towards the N-terminal region of Rat Naa60. Synthetic peptide located within the following region: IVGMIVAEIKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name N(alpha)-acetyltransferase 60, NatF catalytic subunit
Database Link
Background Histone acetyltransferase localized in the Golgi apparatus that mediates acetylation of free histone H4, thereby facilitating nucleosome assembly. Has a preference for free histone H4 'Lys-20'(H4K20ac), 'Lys-79'(H4K79ac) and 'Lys-91' (H4K91ac). Also displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.
Synonyms HAT4; NAT15
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Write Your Own Review
You're reviewing:Naa60 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.