SULT6B1 Rabbit Polyclonal Antibody

SKU TA346693

Rabbit Polyclonal Anti-SULT6B1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SULT6B1 antibody: synthetic peptide directed towards the C terminal of human SULT6B1. Synthetic peptide located within the following region: FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: sulfotransferase family 6B member 1
• Database Link:
  NP_001027549
  Q6IMI4
• Background: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of thyroxine. Involved in the metabolism of thyroxine.
• Synonyms: 2410078J06Rik; AV101767; ST6B1
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Dog: 92%; Rabbit: 92%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data