OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRUB2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA346619
Rabbit Polyclonal Anti-TRUB2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414408 Transient overexpression lysate of TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2) (as WB positive control) 100 ug
$436.00
TP300105 Recombinant protein of human TruB pseudouridine (psi) synthase homolog 2 (E. coli) (TRUB2), 20 µg
20 ug
$867.00

View other "TRUB2 or NM_015679" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRUB2 antibody: synthetic peptide directed towards the N terminal of human TRUB2. Synthetic peptide located within the following region: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 37 kDa
Gene Name TruB pseudouridine synthase family member 2
Database Link
Background Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 PubMed 12736709). supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: AK001956.1, AF131848.1 ECO:0000332 RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 ECO:0000350 ##Evidence-Data-END##
Synonyms CLONE24922
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products