RSU1 Rabbit Polyclonal Antibody

SKU TA346616

Rabbit Polyclonal Anti-RSU1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RSU1 antibody: synthetic peptide directed towards the C terminal of human RSU1. Synthetic peptide located within the following region: PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: Ras suppressor protein 1
• Database Link:
  NP_036557
  Q15404
• Background: This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors. [provided by RefSeq, Jul 2008]
• Synonyms: RSP-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome