TPD52 Rabbit Polyclonal Antibody

SKU
TA346595
Rabbit Polyclonal Anti-TPD52 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution IHC, WB
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TPD52 antibody: synthetic peptide directed towards the middle region of human TPD52. Synthetic peptide located within the following region: AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 24 kDa
Gene Name tumor protein D52
Database Link
Background It belongs to the TPD52 family. Its exact function remains unknown.
Synonyms D52; hD52; N8L; PC-1; PrLZ
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data
Write Your Own Review
You're reviewing:TPD52 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.