Decorin (DCN) Rabbit Polyclonal Antibody

SKU TA346564

Rabbit Polyclonal Anti-DCN Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCN antibody: synthetic peptide directed towards the N terminal of human DCN. Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: decorin
• Database Link:
  NP_001911
  P07585
• Background: The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome. [provided by RefSeq, Jul 2008]
• Synonyms: CSCD; DSPG2; PG40; PGII; PGS2; SLRR1B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Goat: 92%; Sheep: 92%; Bovine: 92%; Rat: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: TGF-beta signaling pathway