IL28 Receptor alpha (IFNLR1) Rabbit Polyclonal Antibody

SKU TA346513

Rabbit Polyclonal Anti-IL28RA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: interferon lambda receptor 1
• Database Link:
  NP_775087
  Q8IU57
• Background: The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
• Synonyms: 12; CRF2; IFNLR; IL-28R1; IL28RA; LICR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 92%; Bovine: 92%; Horse: 86%; Rabbit: 86%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway