PRAS40 (AKT1S1) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AKT1S1 antibody: synthetic peptide directed towards the C terminal of human AKT1S1. Synthetic peptide located within the following region: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 27 kDa |
Gene Name | AKT1 substrate 1 |
Database Link | |
Background | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (5) differs in the 5' UTR and coding sequence compared to variant 1. The resulting isoform (b) is shorter at the N-terminus compared to isoform a. Variants 2, 3, 4, and 5 encode the same isoform (b). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## CDS exon combination :: BC007416.2, BC022241.1 [ECO:0000331] RNAseq introns :: single sample supports all introns ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | Lobe; PRAS40 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.