FAM107A Rabbit Polyclonal Antibody

SKU TA346455

Rabbit Polyclonal Anti-FAM107A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM107A antibody is: synthetic peptide directed towards the N-terminal region of Human FAM107A. Synthetic peptide located within the following region: IQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: family with sequence similarity 107 member A
• Database Link:
  NP_009108
  O95990
• Background: When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
• Synonyms: DRR1; TU3A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 86%

Reference Data