ZNF19 Rabbit Polyclonal Antibody

SKU TA346445

Rabbit Polyclonal Anti-ZNF19 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF19 antibody: synthetic peptide directed towards the N terminal of human ZNF19. Synthetic peptide located within the following region: TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: zinc finger protein 19
• Database Link:
  NP_008892
  P17023
• Background: ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.The protein encoded by this gene contains a zinc finger, a nucleic acid-binding domain present in many transcription factors. This gene is located in a region next to ZNF23, a gene also encoding a zinc finger protein, on chromosome 16.
• Synonyms: KOX12
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors