SLC22A7 Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the N terminal of human SLC22A7. Synthetic peptide located within the following region: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 60 kDa |
Gene Name | solute carrier family 22 member 7 |
Database Link | |
Background | SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. |
Synonyms | NLT; OAT2 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Guinea pig: 93%; Bovine: 92%; Rat: 86%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.