PRSS16 Rabbit Polyclonal Antibody

SKU TA346422

Rabbit Polyclonal Anti-PRSS16 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS16 antibody: synthetic peptide directed towards the middle region of human PRSS16. Synthetic peptide located within the following region: SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: protease, serine 16
• Database Link:
  NP_005856
  Q9NQE7
• Background: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the
• Synonyms: TSSP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Horse: 92%; Bovine: 86%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane