ALS (IGFALS) Rabbit Polyclonal Antibody

SKU TA346388

Rabbit Polyclonal Anti-IGFALS Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: insulin like growth factor binding protein acid labile subunit
• Database Link:
  NP_004961
  P35858
• Background: IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.
• Synonyms: ACLSD; ALS
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein