PF4V1 Rabbit Polyclonal Antibody

SKU TA346326

Rabbit Polyclonal Anti-PF4V1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PF4V1 antibody: synthetic peptide directed towards the middle region of human PF4V1. Synthetic peptide located within the following region: RPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: platelet factor 4 variant 1
• Database Link:
  NP_002611
  P10720
• Background: PF4V1 is the inhibitor of angiogenesis. PF4V1 is the inhibitor of endothelial cell chemotaxis (in vitro).
• Synonyms: CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction