KRT13 Rabbit Polyclonal Antibody

SKU
TA346320
Rabbit Polyclonal Anti-KRT13 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KRT13 antibody: synthetic peptide directed towards the N terminal of human KRT13. Synthetic peptide located within the following region: TMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 46 kDa
Gene Name keratin 13
Database Link
Background KRT13 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of a
Synonyms CK13; K13; WSN2
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Rat: 92%; Sheep: 92%; Bovine: 92%; Rabbit: 86%
Reference Data
Write Your Own Review
You're reviewing:KRT13 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.