KIR2DL4 Rabbit Polyclonal Antibody

SKU
TA346319
Rabbit Polyclonal Anti-KIR2DL4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
Database Link
Background Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
Synonyms CD158D; G9P; KIR-103AS; KIR103; KIR103AS
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane
Protein Pathways Antigen processing and presentation, Natural killer cell mediated cytotoxicity
Write Your Own Review
You're reviewing:KIR2DL4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.