Apof Rabbit Polyclonal Antibody

SKU TA346301

Rabbit Polyclonal Anti-Apof Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Apof antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: apolipoprotein F
• Database Link:
  NP_001019522
  Q5M889
• Background: Apof is a minor apolipoprotein that associates with LDL. Apof inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Apof also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
• Synonyms: Apo-F; DKFZp781G18150; LTIP; MGC22520
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86%; Guinea pig: 86%

Reference Data