CYP4A22 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of cytochrome P450, family 4, subfamily A, polypeptide 22 (CYP4A22)
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "CYP4A22"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 57 kDa |
Gene Name | cytochrome P450 family 4 subfamily A member 22 |
Database Link | |
Background | CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33. |
Synonyms | cytochrome P450; cytochrome P450 4A22; cytochrome P450 4A22K; family 4; OTTHUMP00000009560; polypeptide 22; subfamily A |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rat: 79% |
Reference Data | |
Protein Families | P450, Transmembrane |
Protein Pathways | Arachidonic acid metabolism, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Retinol metabolism, Vascular smooth muscle contraction |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.