CYP4A22 Rabbit Polyclonal Antibody

SKU
TA346247
Rabbit Polyclonal Anti-CYP4A22 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name cytochrome P450 family 4 subfamily A member 22
Database Link
Background CYP4A22 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 1p33.
Synonyms cytochrome P450; cytochrome P450 4A22; cytochrome P450 4A22K; family 4; OTTHUMP00000009560; polypeptide 22; subfamily A
Note Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Rat: 79%
Reference Data
Protein Families P450, Transmembrane
Protein Pathways Arachidonic acid metabolism, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Retinol metabolism, Vascular smooth muscle contraction
Write Your Own Review
You're reviewing:CYP4A22 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.