ABCB4 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 141 kDa |
Gene Name | ATP binding cassette subfamily B member 4 |
Database Link | |
Background | ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Member |
Synonyms | 3; ABC21; GBD1; ICP3; MDR2; MDR3; PFIC-3; PGY3 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%; Pig: 92%; Mouse: 92%; Guinea pig: 92%; Horse: 86%; Rabbit: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | ABC transporters |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.