Steroid sulfatase (STS) Rabbit Polyclonal Antibody

SKU TA346177

Rabbit Polyclonal Anti-STS Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: steroid sulfatase (microsomal), isozyme S
• Database Link:
  NP_000342
  P08842
• Background: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: ARSC; ARSC1; ASC; ES; SSDD; XLI
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Bovine: 90%; Zebrafish: 89%; Guinea pig: 86%; Dog: 80%; Mouse: 77%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Androgen and estrogen metabolism