Steroid sulfatase (STS) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 63 kDa |
| Gene Name | steroid sulfatase (microsomal), isozyme S |
| Database Link | |
| Background | STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosis The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | ARSC; ARSC1; ASC; ES; SSDD; XLI |
| Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Bovine: 90%; Zebrafish: 89%; Guinea pig: 86%; Dog: 80%; Mouse: 77%; Rabbit: 77% |
| Reference Data | |
| Protein Categories | Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Androgen and estrogen metabolism |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Arylsulfatase B mediates the sulfonation-transport interplay in human embryonic kidney (HEK) 293 cells overexpressing sulfotransferase 1A3
Zhao, Wang, Li et al
Drug Metab. Dispos. (2016)
Zhao, Wang, Li et al
Drug Metab. Dispos. (2016)
Cited by 13
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
