FECH Rabbit Polyclonal Antibody

SKU TA346163

Rabbit Polyclonal Anti-FECH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FECH antibody: synthetic peptide directed towards the middle region of human FECH. Synthetic peptide located within the following region: KRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: ferrochelatase
• Database Link:
  NP_000131
  P22830
• Background: FECH is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: EPP; FCE
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Porphyrin and chlorophyll metabolism