FCN3 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FCN3 antibody: synthetic peptide directed towards the N terminal of human FCN3. Synthetic peptide located within the following region: LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 31 kDa |
Gene Name | ficolin 3 |
Database Link | |
Background | Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. |
Synonyms | FCNH; HAKA1 |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Zebrafish: 92%; Pig: 91%; Mouse: 91%; Bovine: 91%; Dog: 79%; Rabbit: 79%; Guinea pig: 77% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.