KRR1 Rabbit Polyclonal Antibody

SKU TA345997

Rabbit Polyclonal Anti-KRR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRR1 antibody: synthetic peptide directed towards the C terminal of human KRR1. Synthetic peptide located within the following region: KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: KRR1, small subunit processome component homolog
• Database Link:
  NP_008974
  Q13601
• Background: KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.
• Synonyms: HRB2; RIP-1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 86%; Zebrafish: 86%

Reference Data