Ribonuclease H2, subunit A (RNASEH2A) Rabbit Polyclonal Antibody

CAT#: TA345962

Rabbit Polyclonal Anti-RNASEH2A Antibody

Product Images

WB Suggested Anti-RNASEH2A Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateRNASEH2A is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-RNASEH2A Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the C terminal of human RNASEH2A. Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: ribonuclease H2 subunit A
• Database Link:
  NP_006388
  Entrez Gene 10535 Human
  UniProt ID O75792
• Background: Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.
• Synonyms: AGS4; JUNB; RNASEHI; RNHIA; RNHL
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Pathways: DNA replication