Synaptojanin 2 (SYNJ2) Rabbit Polyclonal Antibody

SKU TA345863

Rabbit Polyclonal Anti-SYNJ2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 165 kDa
• Gene Name: synaptojanin 2
• Database Link:
  NP_003889
  O15056
• Background: SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.
• Synonyms: INPP5H
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Mouse: 92%; Rat: 86%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system