RTCD1 (RTCA) Rabbit Polyclonal Antibody

SKU TA345850

Rabbit Polyclonal Anti-RTCD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RTCD1 antibody: synthetic peptide directed towards the N terminal of human RTCD1. Synthetic peptide located within the following region: VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: RNA 3'-terminal phosphate cyclase
• Database Link:
  NP_003720
  O00442
• Background: RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.RNA 3-prime-terminal phosphate cyclase (RPC; EC 6.5.1.4) catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA (Genschik et al., 1997 [PubMed 9184239]). [supplied by OMIM]. Sequence Note: removed 1 base from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1538 Y11651.1 1-1538
• Synonyms: RPC; RTC1; RTCD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data