CARS1 Rabbit Polyclonal Antibody

SKU TA345739

Rabbit Polyclonal Anti-CARS Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 84 kDa
• Gene Name: cysteinyl-tRNA synthetase
• Database Link:
  NP_001014438
  P49589
• Background: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several loca
• Synonyms: CARS1; CYSRS; cysteine-tRNA ligase; cysteine translase; cysteine tRNA ligase 1; cysteinyl-tRNA synthetase; cytoplasmic; MGC:11246; OTTHUMP00000012605
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 82%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Aminoacyl-tRNA biosynthesis