CBLL2 Rabbit Polyclonal Antibody

SKU TA345552

Rabbit Polyclonal Anti-ZNF645 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the middle region of human ZNF645. Synthetic peptide located within the following region: LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger protein 645
• Database Link:
  NP_689790
  Q8N7E2
• Background: ZNF645 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions.
• Synonyms: CT138; HAKAIL
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 85%; Dog: 75%

Reference Data