SPIC Rabbit Polyclonal Antibody

SKU TA345537

Rabbit Polyclonal Anti-SPIC Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPIC antibody: synthetic peptide directed towards the middle region of human SPIC. Synthetic peptide located within the following region: LQRLSPSYFLGKEIFYSQCVQPDQEYLSLNNWNANYNYTYANYHELNHHD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: Spi-C transcription factor
• Database Link:
  NP_689536
  Q8N5J4
• Background: SPIC controls the development of red pulp macrophages required for red blood cells recycling and iron homeostasis. SPIC is a transcription factor that binds to the PU-box, a purine-rich DNA sequence (5'-GAGGA[AT]-3') that can act as a lymphoid-specific enhancer. SPIC regulates VCAM1 gene expression.
• Synonyms: SPI-C
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 86%; Horse: 79%

Reference Data

• Protein Families: Transcription Factors