ZNF342 (ZNF296) Rabbit Polyclonal Antibody

SKU TA345523

Rabbit Polyclonal Anti-ZNF342 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the C terminal of human ZNF342. Synthetic peptide located within the following region: YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 296
• Database Link:
  NP_660331
  Q8WUU4
• Background: ZNF342 contains 6 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
• Synonyms: ZFP296; ZNF342
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Dog: 79%

Reference Data

• Protein Families: Transcription Factors