ZNF498 (ZSCAN25) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF498 antibody: synthetic peptide directed towards the C terminal of human ZNF498. Synthetic peptide located within the following region: FSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQEPLVQ |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 51 kDa |
Gene Name | zinc finger and SCAN domain containing 25 |
Database Link | |
Background | The function of ZNF498 remains unknown. The protein bears some similarity to zinc finger proteins, which are involved in DNA binding and protein-protein interactions. Alternative splicing results in two transcript variants encoding different proteins. Additional splice variants have been identified, but their biological validity has not been determined |
Synonyms | ZNF498 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.