ZUP1 Rabbit Polyclonal Antibody

SKU TA345514

Rabbit Polyclonal Anti-C6orf113 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the C terminal of human C6orf113. Synthetic peptide located within the following region: LCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: zinc finger with UFM1 specific peptidase domain
• Database Link:
  NP_659499
  Q96AP4
• Background: The exact function of C6orf113 remains unknown.
• Synonyms: C6orf113; dJ412I7.3
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Mouse: 92%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data