zinc finger protein 655 (ZNF655) Rabbit Polyclonal Antibody

SKU TA345502

Rabbit Polyclonal Anti-ZNF655 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF655 antibody: synthetic peptide directed towards the middle region of human ZNF655. Synthetic peptide located within the following region: EGSFSHSSDLILQQEVLTRQKAFDCDVWEKNSSQRAHLVQHQSIHTKENS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: zinc finger protein 655
• Database Link:
  NP_612503
  Q8N720
• Background: ZNF655 is a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. This gene encodes a zinc finger protein. The zinc finger proteins are involved in DNA binding and protein-protein interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: VIK; VIK-1
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 90%; Bovine: 90%; Rabbit: 90%

Reference Data

• Protein Families: Transcription Factors