Zinc finger protein 682 (ZNF682) Rabbit Polyclonal Antibody

SKU
TA345474
Rabbit Polyclonal Anti-ZNF682 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF682 antibody: synthetic peptide directed towards the middle region of human ZNF682. Synthetic peptide located within the following region: KGFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 58 kDa
Gene Name zinc finger protein 682
Database Link
Background ZNF682 contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF682 may be involved in transcriptional regulation.
Synonyms BC39498_3
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 77%; Pig: 75%; Bovine: 75%; Guinea pig: 75%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Zinc finger protein 682 (ZNF682) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.