MINA53 (MINA) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA. Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 53 kDa |
Gene Name | MYC induced nuclear antigen |
Database Link | |
Background | MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer |
Synonyms | MDIG; MINA53; NO52; ROX |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 92% |
Reference Data | |
Protein Families | Druggable Genome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.