MINA53 (MINA) Rabbit Polyclonal Antibody

SKU TA345456

Rabbit Polyclonal Anti-MINA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA. Synthetic peptide located within the following region: HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: MYC induced nuclear antigen
• Database Link:
  NP_116167
  Q8IUF8
• Background: MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer
• Synonyms: MDIG; MINA53; NO52; ROX
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome