MAD3 (MXD3) Rabbit Polyclonal Antibody

SKU
TA345425
Rabbit Polyclonal Anti-MXD3 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name MAX dimerization protein 3
Database Link
Background MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Synonyms BHLHC13; MAD3; MYX
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Sheep: 93%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:MAD3 (MXD3) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.