PHF17 (JADE1) Rabbit Polyclonal Antibody

SKU TA345410

Rabbit Polyclonal Anti-PHF17 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHF17 antibody: synthetic peptide directed towards the middle region of human PHF17. Synthetic peptide located within the following region: VNLLDVARALRLPEEVVDFLYQYWKLKRKVNFNKPLITPKKDEEDNLAKR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 95 kDa
• Gene Name: jade family PHD finger 1
• Database Link:
  NP_955352
  Q6IE81
• Background: PHF17 belongs to the JADE family. It contains 2 PHD-type zinc fingers. PHF17 is a transcriptional coactivator which seems to act by promoting acetylation of nucleosomal histone H4 by HTATIP. PHF17 promotes apoptosis. Itmay act as a renal tumor suppressor.
• Synonyms: PHF17
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors