ZNF277 Rabbit Polyclonal Antibody

SKU TA345351

Rabbit Polyclonal Anti-ZNF277 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF277 antibody: synthetic peptide directed towards the N terminal of human ZNF277. Synthetic peptide located within the following region: MAASKTQGAVARMQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: zinc finger protein 277
• Database Link:
  NP_068834
  Q9NRM2
• Background: ZNF277 may be involved in transcriptional regulation.
• Synonyms: NRIF4; ZNF277P
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors