Zfp148 Rabbit Polyclonal Antibody

SKU
TA345348
Rabbit Polyclonal Anti-Zfp148 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Zfp148 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Zfp148. Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 87 kDa
Gene Name zinc finger protein 148
Database Link
Background The function of this protein remains unknown.
Synonyms 2210405J08Rik; AI480666; AW045217; BERF-1; BFCOL1; ZBP-89; Zbp-89; Znf148
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 86%
Reference Data
Write Your Own Review
You're reviewing:Zfp148 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.