Zfp148 Rabbit Polyclonal Antibody

SKU TA345348

Rabbit Polyclonal Anti-Zfp148 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Zfp148 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Zfp148. Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 87 kDa
• Gene Name: zinc finger protein 148
• Database Link:
  NP_035879
  Q61624
• Background: The function of this protein remains unknown.
• Synonyms: 2210405J08Rik; AI480666; AW045217; BERF-1; BFCOL1; ZBP-89; Zbp-89; Znf148
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 86%

Reference Data