ZNF70 Rabbit Polyclonal Antibody

SKU TA345343

Rabbit Polyclonal Anti-ZNF70 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF70 antibody: synthetic peptide directed towards the C terminal of human ZNF70. Synthetic peptide located within the following region: GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: zinc finger protein 70
• Database Link:
  NP_068735
  Q9UC06
• Background: The function of the ZNF70 has not yet been determined
• Synonyms: Cos17
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Bovine: 86%; Rabbit: 83%; Zebrafish: 83%; Mouse: 79%; Guinea pig: 77%

Reference Data

• Protein Families: Transcription Factors